What is IGF-1LR3 used for?

IGF-1LR3 is a synthetic peptide compound studied in laboratory research settings. It has molecular formula C400H625N111O115S9, a molecular weight of 9117.5 g/mol, CAS 946870-92-4. Published preclinical research has documented its interactions with the IGF-1 Receptor, PI3K/AKT Signaling Pathway. It is intended for in vitro research use only and is not approved for human consumption.

What purity level does Amino Foundry's IGF-1LR3 have?

Amino Foundry supplies IGF-1LR3 at ≥99% purity, verified by third-party HPLC and mass spectrometry analysis. Certificates of Analysis are available upon request.

How is IGF-1LR3 supplied?

IGF-1LR3 is supplied as a lyophilized powder in sealed research-grade vials, intended for in vitro and laboratory research use only.

Free Shipping Threshold$250 remaining

Back to Catalog

Healing

IGF-1LR3

Name: IGF-1LR3
Brand: Amino Foundry
SKU: AF-IGF1LR3

≥99.1% HPLC Verified Purity

CAS Number946870-92-4

Molecular Weight9117.5 g/mol

Molecular FormulaC₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉

Storage-20 °C, lyophilized

$60.00/ vial

RESEARCH USE ONLY: This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. Not evaluated by the FDA. Must be 21+ to purchase.

What is IGF-1 LR3?

IGF-1 LR3 is a long arginine 3 IGF-1, a recombinant IGF-1 analog with an N-terminal extension and Arg3 substitution. With the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mol (CAS: 143045-27-6), it structurally mimics endogenous peptides while extending its sequence.

Amino Acid Sequence:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK

Classification: Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Specifications

CAS Number	946870-92-4
Molecular Formula	C400H625N111O115S9
Molecular Weight	9117.5 g/mol
Purity	≥99.1% (HPLC verified)
Form	Lyophilized powder
Storage	-20 °C, lyophilized
Shipping	Insulated protective packaging

Mechanism of Action

IGF-1 Receptor

Receptor interaction

Published research demonstrates IGF-1 LR3 modulates targeted signaling cascades within cell tissue models.

PI3K/AKT Signaling Pathway

Signaling cascade

In cellular environments, IGF-1 LR3 exhibits selective binding and corresponding pathway activation.

Storage & Handling

Temperature:-20°C for long-term storage

Light Sensitivity:Protect from direct light

Stability Duration:Stable for 24 months when stored properly

Research-grade sequence verification via standard assays.

Related Compounds

BPC-157 TB-500 CJC-1295 NO DAC

Research Use Only

All compounds are sold strictly for laboratory research use. Not for human use. These products are not drugs, supplements, or food. Statements have not been evaluated by the FDA. Must be 21+ to purchase. This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.